249,633 results match your criteria rat model


Saxagliptin Defers Thioacetamide-Induced Hepatocarcinogenesis in Rats; A Novel Suppressive Impact on Wnt/Hedgehog /Notch1 Signaling.

Environ Toxicol Pharmacol 2021 May 1:103668. Epub 2021 May 1.

Dep. of Pharmacology and Toxicology, Faculty of Pharmacy, Mansoura University, Mansoura, Egypt.

Aim: Hepatocellular carcinoma (HCC) is a highly invasive form of hepatic cancer. It is a highly intricate disease with multiple pathophysiological mechanisms underlying its pathogenesis.

Materials And Methods: The results of the current investigation shed light on the ability of saxagliptin (SAXA) (12. Read More

View Article and Full-Text PDF

Circ_ZFP644 attenuates caerulein-induced inflammatory injury in rat pancreatic acinar cells by modulating miR-106b/Pias3 axis.

Exp Mol Pathol 2021 May 1:104644. Epub 2021 May 1.

Department of Gastroenterology, Shandong Provincial Hospital Affiliated to Shandong First Medical University, Jinan, Shandong, China. Electronic address:

(AP) is a kind of inflammatory misorder existing in pancreas. Non-coding RNAs (ncRNAs) have been reported to play important roles in development of AP. The current study was designed to explore the role of circular RNA zinc finger protein 644 (circRNA circ_ZFP644) in caerulein-induced AR42J cells. Read More

View Article and Full-Text PDF

Empagliflozin ameliorates symptoms of diabetes and renal tubular dysfunction in a rat model of diabetes with enlarged kidney (DEK).

PLoS One 2021 4;16(5):e0251135. Epub 2021 May 4.

Laboratory of Veterinary Physiology, Nippon Veterinary and Life Science University, Tokyo, Japan.

Background: Sodium-glucose cotransporter 2 (SGLT2) inhibitors are widely used to reduce hyperglycemia. The present study investigated the effects of a SGLT2 inhibitor, empagliflozin, on hyperglycemia in a novel rat model of non-obesity type 2 diabetes with enlarged kidney (DEK).

Methods: Male DEK rats with non-fasting blood glucose concentrations ≤300 mg/dl and >300 mg/dl were classified as nondiabetic and diabetic, respectively. Read More

View Article and Full-Text PDF

SPATS1 (spermatogenesis-associated, serine-rich 1) is not essential for spermatogenesis and fertility in mouse.

PLoS One 2021 4;16(5):e0251028. Epub 2021 May 4.

Department of Molecular Biology, Instituto de Investigaciones Biológicas Clemente Estable (IIBCE), Montevideo, Uruguay.

SPATS1 (spermatogenesis-associated, serine-rich 1) is an evolutionarily conserved, testis-specific protein that is differentially expressed during rat male meiotic prophase. Some reports have suggested a link between SPATS1 underexpression/mutation and human pathologies such as male infertility and testicular cancer. Given the absence of functional studies, we generated a Spats1 loss-of-function mouse model using CRISPR/Cas9 technology. Read More

View Article and Full-Text PDF

Mesenchymal stem cell-derived exosomes containing miR-145-5p reduce inflammation in spinal cord injury by regulating the TLR4/NF-κB signaling pathway.

Cell Cycle 2021 May 4:1-17. Epub 2021 May 4.

Department of Health Examination, Jinan Central Hospital Affiliated to Shandong University.

EXs (Exosomes) secreted by mesenchymal stem cells (MSCs) have the potential to treat spinal cord injury (SCI), this study aimed to further explore the therapeutic effect of EXs on SCI. Firstly, EXs were extracted from MSCs and analyzed with a transmission electron microscope. Next, MSCs with or without the miR-145-5p plasmid were injected into the SCI rat model, and then rat damage was evaluated by BBB score, HE staining and Nissl staining. Read More

View Article and Full-Text PDF

Knockdown of hsa_circ_0134111 alleviates the symptom of osteoarthritis via sponging microRNA-224-5p.

Cell Cycle 2021 May 4:1-15. Epub 2021 May 4.

Department of Orthopedics, First Affiliated Hospital of Anhui Medical University, Hefei, Anhui, P.R. China.

The relevance of circular RNAs (circRNAs) has been indicated in the progression of various diseases. Nevertheless, the precise function of circRNAs in osteoarthritis (OA) remains to be established. Therefore, we aimed to investigate changes in the expression of a specific circRNA, hsa_circ_0134111 (circ_PDE1C) and predict its functions in OA. Read More

View Article and Full-Text PDF

Dexmedetomidine targets miR-146a and participates in the progress of chronic obstructive pulmonary disease in vivo and in vitro.

Genes Genomics 2021 Jan 22. Epub 2021 Jan 22.

Department of Anesthesiology, Hainan General Hospital, Road Xiuhua, Haikou, Hainan Province, China.

Background: Chronic obstructive pulmonary disease (COPD) is a chronic lung disease and the third leading cause of death in the world. Dexmedetomidine has been reported to effectively inhibit histamine-induced bronchoconstriction. However, the molecular mechanism of dexmedetomidine in COPD has not been found. Read More

View Article and Full-Text PDF
January 2021

Analgesic and anti-inflammatory potential of Lupeol isolated from Indian traditional medicinal plant Crateva adansonii screened through in vivo and in silico approaches.

J Genet Eng Biotechnol 2021 May 4;19(1):62. Epub 2021 May 4.

Department of Biotechnology, Yeungnam University, Gyeongsan, South Korea.

Background: Lupeol, a triterpene bioactive compound isolated from Indian traditional plant Crateva adansonii acted as promising and alternative anti-inflammatory agent to treatments of diseases related to inflammation. The inflammatory process in the body serves an important function in the control and repair of injury. However, it is self-perpetuating in number of disease conditions, which must be prevented and treated. Read More

View Article and Full-Text PDF

Attenuation of doxorubicin-induced oxidative damage in rat brain by regulating amino acid homeostasis with Astragali Radix.

Amino Acids 2021 May 4. Epub 2021 May 4.

Key Laboratory of Drug Quality Control and Pharmacovigilance, China Pharmaceutical University, Ministry of Education, Nanjing, 210009, China.

The nervous system disorders caused by doxorubicin (DOX) are among the severe adverse effects that dramatically reduce the quality of life of cancer survivors. Astragali Radix (AR), a popular herbal drug and dietary supplement, is believed to help treat brain diseases by reducing oxidative stress and maintaining metabolic homeostasis. Here we show the protective effects of AR against DOX-induced oxidative damage in rat brain via regulating amino acid homeostasis. Read More

View Article and Full-Text PDF

Test-retest reliability of tone- and 40 Hz train-evoked gamma oscillations in female rats and their sensitivity to low-dose NMDA channel blockade.

Psychopharmacology (Berl) 2021 May 4. Epub 2021 May 4.

Department of Pharmaceutical Sciences, Bill Gatton College of Pharmacy, East Tennessee State University, VA Building 7, Room 324, Maple Ave, Johnson City, TN, 37604, USA.

Rationale: Schizophrenia patients consistently show deficits in sensory-evoked broadband gamma oscillations and click-evoked entrainment at 40 Hz, called the 40-Hz auditory steady-state response (ASSR). Since such evoked oscillations depend on cortical N-methyl D-aspartic acid (NMDA)-mediated network activity, they can serve as pharmacodynamic biomarkers in the preclinical and clinical development of drug candidates engaging these circuits. However, there are few test-retest reliability data in preclinical species, a prerequisite for within-subject testing paradigms. Read More

View Article and Full-Text PDF

Polyester Mesh Functionalization with Nitric Oxide-Releasing Silica Nanoparticles Reduces Early Methicillin-Resistant Contamination.

Surg Infect (Larchmt) 2021 Apr 30. Epub 2021 Apr 30.

Houston Methodist Research Institute, Houston, Texas, USA.

Infected hernia mesh is a cause of post-operative morbidity. Nitric oxide (NO) plays a key role in the endogenous immune response to infection. We sought to study the efficacy of a NO-releasing mesh against methicillin-resistant (MRSA). Read More

View Article and Full-Text PDF

Discovery of Potent and Brain-Penetrant Tau Tubulin Kinase 1 (TTBK1) Inhibitors that Lower Tau Phosphorylation In Vivo.

J Med Chem 2021 May 4. Epub 2021 May 4.

Department of Medicinal Chemistry, Biogen, 225 Binney Street, Cambridge, Massachusetts 02142, United States.

Structural analysis of the known NIK inhibitor bound to the kinase domain of TTBK1 led to the design and synthesis of a novel class of azaindazole TTBK1 inhibitors exemplified by (cell IC: 571 nM). Systematic optimization of this series of analogs led to the discovery of , a potent (cell IC: 315 nM) and selective TTBK inhibitor with suitable CNS penetration (rat K: 0.32) for in vivo proof of pharmacology studies. Read More

View Article and Full-Text PDF

Conventional Dorsal Root Ganglion Stimulation in an Experimental Model of Painful Diabetic Peripheral Neuropathy: A Quantitative Immunocytochemical Analysis of Intracellular γ-Aminobutyric Acid in Dorsal Root Ganglion Neurons.

Neuromodulation 2021 May 4. Epub 2021 May 4.

Department of Anesthesiology and Pain Management, Maastricht University Medical Centre (MUMC+), Maastricht, The Netherlands.

Background And Objective: The sensory cell somata in the DRG contain all equipment necessary for extensive GABAergic signaling and are able to release GABA upon depolarization. With this study, we hypothesize that pain relief induced by conventional dorsal root ganglion stimulation (Con-DRGS) in animals with experimental painful diabetic peripheral neuropathy is related to the release of GABA from DRG neurons. With use of quantitative immunocytochemistry, we hypothesize DRGS to result in a decreased intensity of intracellular GABA-immunostaining in DRG somata. Read More

View Article and Full-Text PDF

Ventilation with the noble gas argon in an model of idiopathic pulmonary arterial hypertension in rats.

Med Gas Res 2021 Jul-Sep;11(3):124-125

Department of Pathophysiology and Transplantation, University of Milan; Department of Anesthesiology, Intensive Care and Emergency Fondazione IRCCS Ca' Granda Ospedale Maggiore Policlinico, Milan, Italy.

View Article and Full-Text PDF

Calcyclin (S100A6) Attenuates Inflammatory Response and Mediates Apoptosis of Chondrocytes in Osteoarthritis via the PI3K/AKT Pathway.

Orthop Surg 2021 May 4. Epub 2021 May 4.

Institute of Orthopaedics, Tianjin Hospital, Tianjin, China.

Objective: To clarify the regulatory effect of Calcyclin (S100A6) on chondrocytes apoptosis and its relationship with progression of osteoarthritis in an effort to explore potential therapeutic targets for osteoarthritis.

Method: Immunofluorescence assay was produced to identify the rat chondrocyte sample and western blots assay was detected the expression changes of S100A6 between control group and osteoarthritis model which induced by interleukin-1β. Adenovirus were transfected into the chondrocytes in vitro, in order to regulate the S100A6 expression. Read More

View Article and Full-Text PDF

Therapeutic effect of SP-8356 on pulmonary embolism-associated cardiac injury is mediated by its ability to suppress apoptosis and inflammation.

J Cell Mol Med 2021 May 4. Epub 2021 May 4.

Department of Cardiovascular Medicine, The First Affiliated Hospital of South China University, Hengyang, China.

The cyclophilin A-CD147 interaction has been reported to be one of the most potential therapeutic targets for the treatment of acute pulmonary embolism. The signalling of extracellular signal-regulated kinase 1/2 (ERK1/2) was also reported in the pathogenesis of cardiac injury. Since SP-8356 is regarded as a novel Inhibitor of CD147-Cyclophilin, the study aimed to evaluate potential therapeutic effects of SP-8356 for pulmonary embolism-associated cardiac injury. Read More

View Article and Full-Text PDF

Neuroendocrine changes in the hypothalamic-neurohypophysial system in the Wistar audiogenic rat (WAR) strain submitted to audiogenic kindling.

J Neuroendocrinol 2021 May 4:e12975. Epub 2021 May 4.

Laboratory of Neuroendocrinology, Department of Biophysics, Escola Paulista de Medicina, Federal University of São Paulo, São Paulo, Brazil.

The Wistar audiogenic rat (WAR) strain is used as an animal model of epilepsy, which when submitted to acute acoustic stimulus presents tonic-clonic seizures, mainly dependent on brainstem (mesencephalic) structures. However, when WARs are exposed to chronic acoustic stimuli (audiogenic kindling-AK), they usually present tonic-clonic seizures, followed by limbic seizures, after recruitment of forebrain structures such as the cortex, hippocampus and amygdala. Although some studies have reported that hypothalamic-hypophysis function is also altered in WAR through modulating vasopressin (AVP) and oxytocin (OXT) secretion, the role of these neuropeptides in epilepsy still is controversial. Read More

View Article and Full-Text PDF

Glucagon-like peptide-1 (GLP-1) receptor activation dilates cerebral arterioles, increases cerebral blood flow, and mediates remote (pre)conditioning neuroprotection against ischaemic stroke.

Basic Res Cardiol 2021 May 3;116(1):32. Epub 2021 May 3.

Centre for Cardiovascular and Metabolic Neuroscience, Neuroscience, Physiology and Pharmacology, University College London, Gower Street, London, WC1E 6BT, UK.

Stroke remains one of the most common causes of death and disability worldwide. Several preclinical studies demonstrated that the brain can be effectively protected against ischaemic stroke by two seemingly distinct treatments: remote ischaemic conditioning (RIC), involving cycles of ischaemia/reperfusion applied to a peripheral organ or tissue, or by systemic administration of glucagon-like-peptide-1 (GLP-1) receptor (GLP-1R) agonists. The mechanisms underlying RIC- and GLP-1-induced neuroprotection are not completely understood. Read More

View Article and Full-Text PDF

Sympathectomy decreases pain behaviors and nerve regeneration by downregulating monocyte chemokine CCL2 in dorsal root ganglia in the rat tibial nerve crush model.

Pain 2021 Apr 30. Epub 2021 Apr 30.

Pain Research Center, Department of Anesthesiology, University of Cincinnati College of Medicine, Cincinnati, OH 45267, U.S.A. Department of Anesthesiology, Xiangya Hospital, Central South University, Changsha, Hunan 410008, China. *Present address.

Abstract: Peripheral nerve regeneration is associated with pain in several preclinical models of neuropathic pain. Some neuropathic pain conditions and preclinical neuropathic pain behaviors are improved by sympathetic blockade. In this study we examined the effect of a localized "microsympathectomy," i. Read More

View Article and Full-Text PDF

Development and Preclinical Evaluation of New Inhaled Lipoglycopeptides for the Treatment of Persistent Pulmonary MRSA Infections.

Antimicrob Agents Chemother 2021 May 3. Epub 2021 May 3.

Insmed Incorporated, Bridgewater, New Jersey, USA

Chronic pulmonary MRSA disease in cystic fibrosis (CF) has a high probably of recurrence following treatment with standard-of-care antibiotics and represents an area of unmet need associated with reduced life expectancy. We developed a lipoglycopeptide therapy customized for pulmonary delivery that not only demonstrates potent activity against planktonic MRSA but also against protected colonies of MRSA both in biofilms and within cells, the latter of which have been linked to clinical antibiotic failure. A library of next-generation potent lipoglycopeptides were synthesized with an emphasis on attaining superior pharmacokinetics (PK) and pharmacodynamics to similar compounds of their class. Read More

View Article and Full-Text PDF

Effects of molidustat, a hypoxia-inducible factor prolyl hydroxylase inhibitor, on sodium dynamics in hypertensive subtotally nephrectomized rats.

J Pharmacol Sci 2021 Jun 31;146(2):98-104. Epub 2021 Mar 31.

Department of Pharmacology, Kagawa University, Kagawa, Japan.

Hypoxia-inducible factor prolyl hydroxylase (HIF-PHD) inhibitors were developed for treatment of renal anemia. Patients applicable for HIF-PHD inhibitor treatment experience complications such as chronic kidney disease, whereby water and electrolyte homeostasis is disrupted. The effects of hypoxia-inducible factor stabilization on salt accumulation in the setting of reduced renal function remain unclear. Read More

View Article and Full-Text PDF

Detrusor underactivity causes neurogenic voiding dysfunction in a rat bilateral accessory nerve-injury model.

J Pharmacol Sci 2021 Jun 9;146(2):116-119. Epub 2021 Apr 9.

Department of Hospital Pharmacy, Nagoya City University Graduate School of Pharmaceutical Sciences, 3-1 Tanabe-dori, Mizuho-ku, Nagoya-shi, Aichi-ken 467-8603, Japan; Department of Clinical Pharmaceutics, Nagoya City University, Graduate School of Medical Sciences, 1-Kawasumi, Mizuho-cho, Mizuho-ku, Nagoya-shi, Aichi-ken 467-8601, Japan. Electronic address:

We aimed to investigate detrusor function in a previously developed rat neurogenic voiding dysfunction model that we have developed previously. We performed sham or bilateral accessory nerve injury (BACNI) surgeries on ten-week-old male Wistar/ST rats. One week after surgery, we evaluated detrusor contractility in the bladder using isometric tension and mRNA expression assays. Read More

View Article and Full-Text PDF

Upregulating CXCR7 accelerates endothelial progenitor cell-mediated endothelial repair by activating Akt/Keap-1/Nrf2 signaling in diabetes mellitus.

Stem Cell Res Ther 2021 May 3;12(1):264. Epub 2021 May 3.

Department of Radiology, The Sixth People's Hospital, Affiliated to Shanghai Jiao Tong University, 600 Yi-Shan Road, Shanghai, 200233, People's Republic of China.

Background: Endothelial progenitor cell (EPC) dysfunction contributes to vascular disease in diabetes mellitus. However, the molecular mechanism underlying EPC dysfunction and its contribution to delayed reendothelialization in diabetes mellitus remain unclear. Our study aimed to illustrate the potential molecular mechanism underlying diabetic EPC dysfunction in vivo and in vitro. Read More

View Article and Full-Text PDF

Viscoelasticity measured by shear wave elastography in a rat model of nonalcoholic fatty liver disease: comparison with dynamic mechanical analysis.

Biomed Eng Online 2021 May 3;20(1):45. Epub 2021 May 3.

School of Biomedical Engineering, Health Science Center, Shenzhen University, National-Regional Key Technology Engineering Laboratory for Medical Ultrasound, Guangdong Key Laboratory for Biomedical Measurements and Ultrasound Imaging, Shenzhen, 518000, China.

Background: Nonalcoholic fatty liver disease (NAFLD) is rapidly becoming one of the most common liver diseases. Ultrasound elastography has been used for the diagnosis of NAFLD. However, clinical research on steatosis by elastography technology has mainly focused on steatosis with fibrosis or non-alcoholic steatohepatitis (NASH), while steatosis without fibrosis has been poorly studied. Read More

View Article and Full-Text PDF

Antioxidant Properties of Galanin and Its N-Terminal Fragments in in vitro and in vivo Oxidative Stress Modeling.

Biochemistry (Mosc) 2021 Apr;86(4):496-505

National Medical Research Center for Cardiology, Ministry of Health of the Russian Federation, Moscow, 121552, Russia.

Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue WTLNSAGYLLGPβAH (G2) were studied in vivo in the rat model of regional myocardial ischemia and reperfusion and in vitro in the process of Cu2+-induced free radical oxidation of human blood plasma low-density lipoproteins. Intravenous administration of G1, G2, and Gal to rats after ischemia induction reduced the infarction size and activities of the necrosis markers, creatine kinase-MB and lactate dehydrogenase, in blood plasma at the end of reperfusion. G1, G2, and Gal reduced formation of the spin adducts of hydroxyl radicals in the interstitium of the area at risk during reperfusion, moreover, G2 and Gal also reduced formation of the secondary products of lipid peroxidation in the reperfused myocardium. Read More

View Article and Full-Text PDF

Polyethylene glycol-20k reduces post-resuscitation cerebral dysfunction in a rat model of cardiac arrest and resuscitation: A potential mechanism.

Biomed Pharmacother 2021 May 1;139:111646. Epub 2021 May 1.

Department of Critical Care Medicine, The First Affiliated Hospital of Xi'an Jiaotong University, 277 Yanta West Street, Xi'an, Shaanxi 710061, China; Weil Institute of Emergency and Critical Care Research, Virginia Commonwealth University, Richmond, VA, USA; Department of Emergency Medicine, Virginia Commonwealth University Health System, Richmond, VA, USA. Electronic address:

Out-of-hospital cardiac arrest (CA) is a leading cause of death in the United States. Severe post-resuscitation cerebral dysfunction is a primary cause of poor outcome. Therefore, we investigate the effects of polyethylene glycol-20k (PEG-20k), a cell impermeant, on post-resuscitation cerebral function. Read More

View Article and Full-Text PDF

Mirogabalin, a novel ligand for αδ subunit of voltage-gated calcium channels, improves cognitive impairments in repeated intramuscular acidic saline injection model rats, an experimental model of fibromyalgia.

Biomed Pharmacother 2021 Apr 30;139:111647. Epub 2021 Apr 30.

Specialty Medicine Research Laboratories I, Daiichi-Sankyo Co., Ltd., 1-2-58, Hiromachi, Shinagawa-ku, Tokyo 140-8710, Japan. Electronic address:

Mirogabalin is a novel potent and selective ligand for the αδ subunit of voltage-gated calcium channels, and shows potent and sustained analgesic effects in neuropathic pain and fibromyalgia models. Fibromyalgia is often associated with multiple comorbid symptoms, such as anxiety, depression and cognitive impairment. In the present study, we investigated the effects of mirogabalin on cognitive impairments in an experimental animal model for fibromyalgia, repeated intramuscular acidic saline injection model (Sluka model) rats. Read More

View Article and Full-Text PDF

Model-based prediction of muscarinic receptor function from auditory mismatch negativity responses.

Neuroimage 2021 Apr 30:118096. Epub 2021 Apr 30.

Translational Neuromodeling Unit, Institute for Biomedical Engineering, University of Zurich & Swiss Institute of Technology (ETH Zurich), Wilfriedstrasse 6, 8032, Zurich, Switzerland; Wellcome Centre for Human Neuroimaging, University College London. 12 Queen Square, London, WC1N, 3AR, UK; Max Planck Institute for Metabolism Research, Gleueler Strasse 50, 50931 Cologne, Germany.

Drugs affecting neuromodulation, for example by dopamine or acetylcholine, take centre stage among therapeutic strategies in psychiatry. These neuromodulators can change both neuronal gain and synaptic plasticity and therefore affect electrophysiological measures. An important goal for clinical diagnostics is to exploit this effect in the reverse direction, i. Read More

View Article and Full-Text PDF

Nicotine Exposure Via Electronic Cigarettes Significantly Impedes Biomechanical Healing Properties of Tendon Healing in a Rat Model.

Arthroscopy 2021 Apr 30. Epub 2021 Apr 30.

Department of Orthopaedics and Rehabilitation, Penn State College of Medicine, Milton S. Hershey Medical Center, Hershey, Pennsylvania, U.S.A.

Purpose: The purpose of this study was to evaluate the biomechanical and histological effects on Achilles tendon repair between inhaled combusted tobacco versus nicotine exposure via electronic cigarette versus a control group in a small animal (Sprague Dawley Rat) model.

Methods: Fifty-four Sprague Dawley rats were randomized to three groups: 1) combusted tobacco, 2) e-cigarettes 3) control. Experimental rats were exposed in a smoking chamber for 4 weeks with research cigarettes or electronic cigarette vapor. Read More

View Article and Full-Text PDF