76,048 results match your criteria lipid peroxidation


Metabolomics screening of serum biomarkers for occupational exposure of titanium dioxide nanoparticles.

Nanotoxicology 2021 May 7:1-18. Epub 2021 May 7.

Department of Occupational and Environmental Health Sciences, School of Public Health, Peking University, Beijing, China.

Although nanotoxicology studies have shown that respiratory exposure of titanium dioxide nanoparticles (TiO NPs) could induce adverse health effects, limited biomarkers associated with occupational exposure of TiO NPs were reported. The purpose of this study is to screen serum biomarkers among workers occupationally exposed to TiO NPs using metabolomics. Compared with the control group, a total of 296 serum metabolites were differentially expressed in the TiO NPs-exposed group, of which the relative expression of 265 metabolites increased, and the remaining 31 decreased. Read More

View Article and Full-Text PDF

Evolutionary and functional analyses demonstrate conserved ferroptosis protection by Arabidopsis GPXs in mammalian cells.

FASEB J 2021 Jun;35(6):e21550

Ministry of Education Key Laboratory for Ecology of Tropical Islands, Key Laboratory of Tropical Animal and Plant Ecology of Hainan Province, College of Life Sciences, Hainan Normal University, Haikou, China.

Species have evolved unique mechanisms to combat the effects of oxidative stress inside cells. A particularly devastating consequence of an unhindered oxidation of membrane lipids in the presence of iron results in cell death, known as ferroptosis. Hallmarks of ferroptosis, including peroxidation of polyunsaturated fatty acids, are conserved among animals and plants, however, early divergence of an ancestral mammalian GPX4 (mGPX4) has complicated our understanding of mechanistic similarities between species. Read More

View Article and Full-Text PDF

Antibacterial and antioxidant activities of extracts and isolated compounds from the roots extract of Cucumis prophetarum and in silico study on DNA gyrase and human peroxiredoxin 5.

BMC Chem 2021 May 6;15(1):32. Epub 2021 May 6.

Department of Applied Chemistry, School of Applied Natural Science, Adama Science and Technology University, P.O.Box 1888, Adama, Ethiopia.

Background: Cucumis prophetarum is traditionally used to treat liver and lung disorders, heart failure, diarrhea, gonorrhea, skin infections, intestinal problems and cancer. In the present work, the isolation of two novel compounds along with their antibacterial and antioxidant activities is reported for the first time.

Methods: Silica gel column chromatography was applied to separate constituents of the roots of C. Read More

View Article and Full-Text PDF

Transferrin receptor 1 ablation in satellite cells impedes skeletal muscle regeneration through activation of ferroptosis.

J Cachexia Sarcopenia Muscle 2021 May 6. Epub 2021 May 6.

Guangdong Provincial Key Laboratory of Microbial Culture Collection and Application, State Key Laboratory of Applied Microbiology Southern China, Institute of Microbiology, Guangdong Academy of Sciences, Guangzhou, China.

Background: Satellite cells (SCs) are critical to skeletal muscle regeneration. Inactivation of SCs is linked to skeletal muscle loss. Transferrin receptor 1 (Tfr1) is associated with muscular dysfunction as muscle-specific deletion of Tfr1 results in growth retardation, metabolic disorder, and lethality, shedding light on the importance of Tfr1 in muscle physiology. Read More

View Article and Full-Text PDF

Delphinidin modulates JAK/STAT3 and MAPKinase signaling to induce apoptosis in HCT116 cells.

Environ Toxicol 2021 May 6. Epub 2021 May 6.

Department of Gastroenterology, First Affiliated Hospital of Xi'an Jiaotong University, Xi'an, Shaanxi, China.

Delphinidin is an anthocyanin that belongs to the group of flavonoids that exert numerous biological activities. However, the molecular mechanisms underlying the anticancer effects of delphinidin remain poorly understood. In our study we analyzed delphinidin modulate STAT-3 and MAPKinase signaling thereby inhbits cell proliferation and promote apoptosis. Read More

View Article and Full-Text PDF

Oral Administration of Gintonin Protects the Brains of Mice against A-Induced Alzheimer Disease Pathology: Antioxidant and Anti-Inflammatory Effects.

Oxid Med Cell Longev 2021 16;2021:6635552. Epub 2021 Apr 16.

Division of Life Science and Applied Life Science (BK21 FOUR), College of Natural Sciences, Gyeongsang National University, Jinju 52828, Republic of Korea.

The study was aimed at analyzing the protective effects of gintonin in an amyloid beta- (A-) induced Alzheimer's disease (AD) mouse model. For the development of the A-induced AD mouse model, the amyloid- (A) peptide was stereotaxically injected into the brains of mice. Subsequently, gintonin was administered at a dose of 100 mg/kg/day/per oral (p. Read More

View Article and Full-Text PDF

Amelioration of Pterostilbene Antiproliferative, Proapoptotic, and Oxidant Potentials in Human Breast Cancer MCF7 Cells Using Zein Nanocomposites.

Int J Nanomedicine 2021 27;16:3059-3071. Epub 2021 Apr 27.

Department of Pharmaceutics, Faculty of Pharmacy, Modern University for Technology and Information (MTI), Cairo, 11571, Egypt.

Purpose: This study aimed to explain the influence of zein nanosphere (ZN NS) formulation on the pharmacotherapeutic profile of PTS in MCF7 cells.

Methods: Liquid-liquid phase separation was used to formulate PTS-ZN NSs. The formulations developed were evaluated for particle-size analysis, encapsulation efficiency, and in vitro diffusion. Read More

View Article and Full-Text PDF

Mitochondrial ferritin attenuates cerebral ischaemia/reperfusion injury by inhibiting ferroptosis.

Cell Death Dis 2021 May 5;12(5):447. Epub 2021 May 5.

Laboratory of Molecular Iron Metabolism, Key Laboratory of Animal Physiology, Biochemistry and Molecular Biology of Hebei Province, Ministry of Education Key Laboratory of Molecular and Cellular Biology, College of Life Science, Hebei Normal University, 050024, Shijiazhuang, Hebei Province, China.

Ischaemic stroke is becoming the most common cerebral disease in aging populations, but the underlying molecular mechanism of the disease has not yet been fully elucidated. Increasing evidence has indicated that an excess of iron contributes to brain damage in cerebral ischaemia/reperfusion (I/R) injury. Although mitochondrial ferritin (FtMt) plays a critical role in iron homeostasis, the molecular function of FtMt in I/R remains unknown. Read More

View Article and Full-Text PDF

Comparative transcriptomic analysis reveals an association of gibel carp fatty liver with ferroptosis pathway.

BMC Genomics 2021 May 5;22(1):328. Epub 2021 May 5.

College of Fisheries, Huazhong Agricultural University, Wuhan, 430070, China.

Background: Fatty liver has become a main problem that causes huge economic losses in many aquaculture modes. It is a common physiological or pathological phenomenon in aquaculture, but the causes and occurring mechanism are remaining enigmatic.

Methods: Each three liver samples from the control group of allogynogenetic gibel carp with normal liver and the overfeeding group with fatty liver were collected randomly for the detailed comparison of histological structure, lipid accumulation, transcriptomic profile, latent pathway identification analysis (LPIA), marker gene expression, and hepatocyte mitochondria analyses. Read More

View Article and Full-Text PDF

Vitamin D deficiency exacerbates hepatic oxidative stress and inflammation during acetaminophen-induced acute liver injury in mice.

Int Immunopharmacol 2021 May 2;97:107716. Epub 2021 May 2.

First Affiliated Hospital, Anhui Medical University, Hefei 230032, China. Electronic address:

Several experiments confirmed that vitamin D3 protected against acetaminophen (APAP)-induced acute liver injury (ALI). This research aimed to evaluate the influence of vitamin D deficiency (VDD) on APAP-induced ALI. In VDD and VDD + APAP groups, mice were fed with VDD diet. Read More

View Article and Full-Text PDF

New markers of oxidative stress in lichen planus and the influence of hepatitis C virus infection - a pilot study.

Rom J Intern Med 2021 May 5. Epub 2021 May 5.

"Carol Davila" University of Medicine and Pharmacy, 37 Dionisie Lupu, 020021Bucharest, Romania.

Introduction: Lichen planus (LP) is a mucocutaneous T-cell mediated disorder of unknown etiology. There is growing evidence that oxidative stress is an important player in the pathogenesis of LP. Therefore, we have investigated oxidative stress markers in LP and the influence of hepatitis C virus (HCV) infection, a frequently associated condition, on oxidative stress in LP patients. Read More

View Article and Full-Text PDF

Curcumin Attenuates Sarcopenia in Chronic Forced Exercise Executed Aged Mice by Regulating Muscle Degradation and Protein Synthesis with Antioxidant and Anti-inflammatory Effects.

J Agric Food Chem 2021 May 5. Epub 2021 May 5.

Department of Food Science and Biotechnology, Sejong University, 209, Neungdong-ro, Gwangjin-gu, Seoul 05006, Republic of Korea.

The aim of the current study is to investigate the effects of spray dry powders of containing 40% curcumin (CM-SD), as a new aqueous curcumin formula, on sarcopenia in chronic forced exercise executed 10 month old ICR mice. CM-SD (80 and 40 mg/kg) increased calf thicknesses and strengths, total body and calf protein amounts, and muscle weights in both gastrocnemius and soleus muscles. mRNA expressions regarding muscle growth and protein synthesis were induced, while those of muscle degradation significantly declined in CM-SD treatment. Read More

View Article and Full-Text PDF

Modulator effect of mangiferin on biochemical characterization in 7,12-dimethylbenz[a]anthracene induced oral cancer in experimental hamsters.

Vet Med Sci 2021 May 5. Epub 2021 May 5.

Department of Intensive Care Medicine, Qingdao Municipal Hospital, Qingdao, China.

Background: Newly, chemo-preventive technique might be a hopeful advancement in developing countries for treating cancers with the aid of toxic less natural based constituents. Malignancy urges to augment effectual chemo-preventive agents that are look forward to suppress the tumours which may be stimulated by chewing and smoking of tobacco and over alcohol consumption related with the high prevalence of human oral cancer (OC) patients.

Methods: In the present research, we examined to assess antioxidants, lipid peroxidation (LPO) and detoxification enzymes levels of anticancer activity of mangiferin on 0. Read More

View Article and Full-Text PDF

Antofine inhibits postharvest green mold due to imazalil-resistant Penicillium digitatum strain Pdw03 by triggering oxidative burst.

J Food Biochem 2021 May 5:e13751. Epub 2021 May 5.

School of Chemical Engineering, Xiangtan University, Xiangtan, China.

The emergence of imazalil (IMZ) resistance in Penicillium digitatum has become a great threat for controlling citrus green mold. In this paper, we investigated the antifungal efficiency and mechanism of an alkaloid antofine against an IMZ-resistant P. digitatum strain Pdw03. Read More

View Article and Full-Text PDF

Preventive effect of Bacillus mojavensis levan against carbon tetrachloride and cisplatin toxicity: in vivo study.

Environ Sci Pollut Res Int 2021 May 5. Epub 2021 May 5.

Laboratory of Plants Improvement and Valorization of Agroressources, National School of Engineering of Sfax (ENIS), University of Sfax, 3038, Sfax, Tunisia.

This study is the first to investigate the hepato- and nephron-preventive effect of levan from Bacillus mojavensis (BM-levan) against toxicity induced by carbon tetrachloride (CCl) and cisplatin. Thirty-six male albino rats weighing between 230 and 250 g were used for this experiment. The groups received multiples doses of BM-levan and were compared to the untreated group. Read More

View Article and Full-Text PDF

Amylin Dyshomeostasis Hypothesis: Small Vessel-Type Ischemic Stroke in the Setting of Type-2 Diabetes.

Stroke 2021 May 5:STROKEAHA121034363. Epub 2021 May 5.

Department of Neurology, University of Kentucky, Lexington. (F.D., L.B.G.).

Recent histological analyses of human brains show that small vessel-type injuries in the setting of type-2 diabetes colocalize with deposits of amylin, an amyloid-forming hormone secreted by the pancreas. Amylin inclusions are also identified in circulating red blood cells in people with type-2 diabetes and stroke or cardiovascular disease. In laboratory models of type-2 diabetes, accumulation of aggregated amylin in blood and the cerebral microvasculature induces brain microhemorrhages and reduces cerebral blood flow leading to white matter ischemia and neurological deficits. Read More

View Article and Full-Text PDF

Effectiveness of N-Acetylcysteine in the Treatment of Renal Deterioration Caused by Long-Term Exposure to Bisphenol A.

Biomolecules 2021 Apr 29;11(5). Epub 2021 Apr 29.

Renal Physiology Unit, Department of Physiology, Faculty of Medicine, Chiang Mai University, Chiang Mai 50200, Thailand.

Human health hazards caused by bisphenol A (BPA), a precursor for epoxy resins and polycarbonate-based plastics, are well documented and are closely associated with mitochondrial impairment and oxidative imbalance. This study aimed to assess the therapeutic efficacy of N-acetylcysteine (NAC) on renal deterioration caused by long-term BPA exposure and examine the signaling transduction pathway involved. Male Wistar rats were given vehicle or BPA orally for 12 weeks then the BPA-treated group was subdivided to receive vehicle or NAC concurrently with BPA for a further 4 weeks, while the vehicle-treated normal control group continued to receive vehicle through to the end of experiment. Read More

View Article and Full-Text PDF

Tauroursodeoxycholic Acid (TUDCA)-Lipid Interactions and Antioxidant Properties of TUDCA Studied in Model of Photoreceptor Membranes.

Membranes (Basel) 2021 Apr 29;11(5). Epub 2021 Apr 29.

Department of Biophysics, Faculty of Biochemistry, Biophysics and Biotechnology, Jagiellonian University, 30-387 Krakow, Poland.

Tauroursodeoxycholic acid (TUDCA), a hydrophilic bile acid containing taurine conjugated with the ursodeoxycholic acid (UDCA), has been known and used from ancient times as a therapeutic compound in traditional Chinese medicine. TUDCA has recently been gaining significant interest as a neuroprotective agent, also exploited in the visual disorders. Among several mechanisms of TUDCA's protective action, its antioxidant activity and stabilizing effect on mitochondrial and plasma membranes are considered. Read More

View Article and Full-Text PDF

Features of the Metabolic Profile of Saliva in Lung Cancer and COPD: The Effect of Smoking Status.

Metabolites 2021 Apr 30;11(5). Epub 2021 Apr 30.

Department of Oncology, Omsk State Medical University, 644099 Omsk, Russia.

The aim of the study was to compare the metabolic characteristics of the salivary composition in lung cancer, chronic obstructive pulmonary disease (COPD) and their combination, depending on the smoking history. The study group included 392 patients with lung cancer of various histological types. The division into subgroups was carried out in accordance with the severity of COPD and smoking experience. Read More

View Article and Full-Text PDF

Comparison of Anticancer Activity of Extract on MCF-7 and MCF-12A Cell Line: Correlation with Invasion and Adhesion.

Biomolecules 2021 Apr 30;11(5). Epub 2021 Apr 30.

Department of Pharmacy, Università degli Studi "Gabriele d'Annunzio", Via dei Vestini 31, 66100 Chieti, Italy.

subsp. is an important medicinal plant in several countries, including Turkey. This study aimed to evaluate the cytotoxicity of a crude extract of subsp. Read More

View Article and Full-Text PDF

High Temperature Alters Secondary Metabolites and Photosynthetic Efficiency in .

Int J Mol Sci 2021 Apr 30;22(9). Epub 2021 Apr 30.

Department of Analytical Chemistry, Medical University of Lublin, Chodźki 4a, 20-093 Lublin, Poland.

Due to global warming, invasive species have spread across the world. We therefore studied the impact of short-term (1 day or 2 days) and longer (7 days) heat stress on photosynthesis and secondary metabolites in , one of the important invasive species in the European Union. leaves exposed to short-term heat stress (35 °C/1 d) showed a decrease in chlorophyll and maximum potential quantum efficiency of photosystem II (Fv/Fm) compared to control, 35 °C/2 d, or 30 °C/7 d treatments. Read More

View Article and Full-Text PDF

Novel antiadipogenic effect of menadione in 3T3-L1 cells.

Chem Biol Interact 2021 May 1:109491. Epub 2021 May 1.

Instituto de Investigaciones Bioquímicas de Bahía Blanca, Universidad Nacional Del Sur (UNS)-Consejo Nacional de Investigaciones Científicas y Técnicas (CONICET), Bahía Blanca, Argentina. Departamento de Biología, Bioquímica y Farmacia, UNS, Bahía Blanca, Argentina. Electronic address:

Inhibition of adipocyte differentiation can be used as a strategy for preventing adipose tissue expansion and, consequently, for obesity management. Since reactive oxygen species (ROS) have emerged as key modulators of adipogenesis, the effect of menadione (a synthetic form of vitamin K known to induce the increase of intracellular ROS) on 3T3-L1 preadipocyte differentiation was studied. Menadione (15 μM) increased ROS and lipid peroxidation, generating mild oxidative stress without affecting cell viability. Read More

View Article and Full-Text PDF

Perception and first defense responses against pv. in L.: identification of Wall-Associated Kinase receptors.

Phytopathology 2021 May 4. Epub 2021 May 4.

Universidad de León - Campus de Vegazana, 16762, Fisiología Vegetal, Campus de Vegazana s/n Facultad de Biología Fisiología vegetal, León, Leon, España, Spain, 24071;

Common bean ( L.) is attacked by several pathogens such as the biotrophic gamma-proteobacterium pv. (Pph). Read More

View Article and Full-Text PDF

Antioxidant Properties of Galanin and Its N-Terminal Fragments in in vitro and in vivo Oxidative Stress Modeling.

Biochemistry (Mosc) 2021 Apr;86(4):496-505

National Medical Research Center for Cardiology, Ministry of Health of the Russian Federation, Moscow, 121552, Russia.

Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue WTLNSAGYLLGPβAH (G2) were studied in vivo in the rat model of regional myocardial ischemia and reperfusion and in vitro in the process of Cu2+-induced free radical oxidation of human blood plasma low-density lipoproteins. Intravenous administration of G1, G2, and Gal to rats after ischemia induction reduced the infarction size and activities of the necrosis markers, creatine kinase-MB and lactate dehydrogenase, in blood plasma at the end of reperfusion. G1, G2, and Gal reduced formation of the spin adducts of hydroxyl radicals in the interstitium of the area at risk during reperfusion, moreover, G2 and Gal also reduced formation of the secondary products of lipid peroxidation in the reperfused myocardium. Read More

View Article and Full-Text PDF

Lysosomal nitric oxide determines transition from autophagy to ferroptosis after exposure to plasma-activated Ringer's lactate.

Redox Biol 2021 Apr 23;43:101989. Epub 2021 Apr 23.

Department of Pathology and Biological Responses, Nagoya University Graduate School of Medicine, 65 Tsurumai-cho, Showa-ku, Nagoya, 466-8550, Japan; Center for Low Temperature Plasma Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, 464-8603, Japan; Sydney Medical School, The University of Sydney, Sydney, NSW, 2006, Australia. Electronic address:

Non-thermal plasma (NTP), an engineered technology to generate reactive species, induces ferroptosis and/or apoptosis specifically in various-type cancer cells. NTP-activated Ringer's lactate (PAL) is another modality for cancer therapy at preclinical stage. Here we found that PAL induces selective ferroptosis of malignant mesothelioma (MM) cells, where non-targeted metabolome screening identified upregulated citrulline-nitric oxide (NO) cycle as a PAL target. Read More

View Article and Full-Text PDF

Acrolein Induces Systemic Coagulopathy via Autophagy-dependent Secretion of von Willebrand Factor in Mice after Traumatic Brain Injury.

Neurosci Bull 2021 May 3. Epub 2021 May 3.

Department of Neurosurgery, Tangdu Hospital, Fourth Military Medical University, Xi'an, 710038, China.

Traumatic brain injury (TBI)-induced coagulopathy has increasingly been recognized as a significant risk factor for poor outcomes, but the pathogenesis remains poorly understood. In this study, we aimed to investigate the causal role of acrolein, a typical lipid peroxidation product, in TBI-induced coagulopathy, and further explore the underlying molecular mechanisms. We found that the level of plasma acrolein in TBI patients suffering from coagulopathy was higher than that in those without coagulopathy. Read More

View Article and Full-Text PDF

Chronic Exposure to Continuous Brightness or Darkness Modulates Immune Responses and Ameliorates the Antioxidant Enzyme System in Male Rats.

Authors:
Amira Moustafa

Front Vet Sci 2021 15;8:621188. Epub 2021 Apr 15.

Department of Physiology, Faculty of Veterinary Medicine, Zagazig University, Zagazig, Egypt.

Circadian rhythms are considered vital regulators of immune functions. This study aims to elucidate the effects of chronic circadian disruption on immune functions, clock genes expression, and antioxidant enzymes levels in lymphoid tissues. Adult male Sprague-Dawley rats were subjected to a normal light/dark cycle or either continuous light (LL) or continuous dark (DD) for 8 weeks. Read More

View Article and Full-Text PDF

Cucurbituril Ameliorates Liver Damage Induced by Microcystis aeruginosa in a Mouse Model.

Front Chem 2021 14;9:660927. Epub 2021 Apr 14.

School of Engineering and Science, Jacobs University Bremen, Bremen, Germany.

is a cyanobacterium that produces a variety of cyclic heptapeptide toxins in freshwater. The protective effects of the macromolecular container cucurbit[7]uril (CB7) were evaluated using mouse models of cyanotoxin-induced liver damage. Biochemical analysis of liver function was performed to gauge the extent of liver damage after exposure to cyanobacterial crude extract [CCE; LD = 35 mg/kg body weight; intraperitoneal (i. Read More

View Article and Full-Text PDF

Lipid Peroxidation With Implication of Organic Pollution in Autistic Behaviors.

Cureus 2021 Mar 30;13(3):e14188. Epub 2021 Mar 30.

Department of Anatomy, Graduate School of Science and Technology for Innovation, Yamaguchi University, Ube, 755-8611, JPN.

Background Lipid metabolism has been associated with the development of autism. The omega-3 and omega-6 polyunsaturated fatty acids (PUFAs) readily undergo lipid peroxidation and conversion to malondialdehyde (MDA). MDA-modified low-density lipoprotein (MDA-LDL) is a marker of lipid peroxidation. Read More

View Article and Full-Text PDF

Antimicrobial activity of 405 nm light-emitting diode (LED) in the presence of riboflavin against on the surface of smoked salmon.

Food Sci Biotechnol 2021 Apr 12;30(4):609-618. Epub 2021 Mar 12.

Department of Food Science and Technology, Korea National University of Transportation, 61, Daehak-ro, Jeungpyeong-gun, Chungbuk, 27909 Republic of Korea.

This study investigated the antimicrobial activity of 405 nm light-emitting diode (LED) with and without riboflavin against in phosphate buffered saline (PBS) and on smoked salmon at different storage temperatures and evaluated its impact on food quality. The results show that riboflavin-mediated LED illumination in PBS 25 °C significantly inactivated cells by 6.2 log CFU/mL at 19. Read More

View Article and Full-Text PDF