10,901 results match your criteria bacteriocin


Tetramic Acids Mutanocyclin and Reutericyclin A, Produced by Strain B04Sm5 Modulate the Ecology of an Oral Biofilm.

Front Oral Health 2021 7;2:796140. Epub 2022 Jan 7.

Genomic Medicine Group, J. Craig Venter Institute, La Jolla, CA, United States.

The human oral microbiome consists of diverse microbes actively communicating and interacting through a variety of biochemical mechanisms. Dental caries is a major public health issue caused by fermentable carbohydrate consumption that leads to dysbiosis of the oral microbiome. is a known major contributor to caries pathogenesis, due to its exceptional ability to form biofilms in the presence of sucrose, as well as to its acidophilic lifestyle. Read More

View Article and Full-Text PDF
January 2022

ECF Sigma Factor HxuI Is Critical for Fitness of during Infection.

Microbiol Spectr 2022 Jan 19:e0162021. Epub 2022 Jan 19.

State Key Laboratory of Medicinal Chemical Biology, Key Laboratory of Molecular Microbiology and Technology of the Ministry of Education, College of Life Sciences, Nankai Universitygrid.216938.7, Tianjin, China.

The opportunistic pathogen Pseudomonas aeruginosa often adapts to its host environment and causes recurrent nosocomial infections. The extracytoplasmic function (ECF) sigma factor enables bacteria to alter their gene expression in response to host environmental stimuli. Here, we report an ECF sigma factor, HxuI, which is rapidly induced once P. Read More

View Article and Full-Text PDF
January 2022

Complete sequences of epidermin and nukacin encoding plasmids from oral-derived Staphylococcus epidermidis and their antibacterial activity.

PLoS One 2022 18;17(1):e0258283. Epub 2022 Jan 18.

Department of Bacteriology, Hiroshima University Graduate School of Biomedical and Health Sciences, Hiroshima, Japan.

Staphylococcus epidermidis is a commensal bacterium in humans. To persist in the bacterial flora of the host, some bacteria produce antibacterial factors such as the antimicrobial peptides known as bacteriocins. In this study, we tried to isolate bacteriocin-producing S. Read More

View Article and Full-Text PDF
January 2022

Biopreservation of beer: Potential and constraints.

Biotechnol Adv 2022 Jan 14:107910. Epub 2022 Jan 14.

Institute of Fermentation Technology and Microbiology, Faculty of Biotechnology and Food Sciences, Lodz University of Technology, 171/173 Wolczanska Street, 90-530 Lodz, Poland. Electronic address:

The biopreservation of beer, using only antimicrobial agents of natural origin to ensure microbiological stability, is of great scientific and commercial interest. This review article highlights progress in the biological preservation of beer. It describes the antimicrobial properties of beer components and microbiological spoilage risks. Read More

View Article and Full-Text PDF
January 2022

Diversity of bacteriocins in the microbiome of the Tucuruí Hydroelectric Power Plant water reservoir and three-dimensional structure prediction of a zoocin.

Genet Mol Biol 2022 5;45(1):e20210204. Epub 2022 Jan 5.

Parque de Ciência e Tecnologia Guamá, Laboratório de Engenharia Biológica, Belém, PA, Brazil.

Bacteriocins are antimicrobial peptides expressed by bacteria through ribosomal activity. In this study, we analyzed the diversity of bacteriocin-like genes in the Tucuruí-HPP using a whole-metagenome shotgun sequencing approach. Three layers of the water column were analyzed (photic, aphotic and sediment). Read More

View Article and Full-Text PDF
January 2022

Recombinant production of the lantibiotic nisin using Corynebacterium glutamicum in a two-step process.

Microb Cell Fact 2022 Jan 15;21(1):11. Epub 2022 Jan 15.

Institute of Microbiology and Biotechnology, University of Ulm, Albert-Einstein-Allee 11, 89081, Ulm, Germany.

Background: The bacteriocin nisin is naturally produced by Lactococcus lactis as an inactive prepeptide that is modified posttranslationally resulting in five (methyl-)lanthionine rings characteristic for class Ia bacteriocins. Export and proteolytic cleavage of the leader peptide results in release of active nisin. By targeting the universal peptidoglycan precursor lipid II, nisin has a broad target spectrum including important human pathogens such as Listeria monocytogenes and methicillin-resistant Staphylococcus aureus strains. Read More

View Article and Full-Text PDF
January 2022

A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits and Extends the Shelf Life of Beef in Combination with Chitosan.

J Agric Food Chem 2022 Jan 12. Epub 2022 Jan 12.

College of Food Science & Engineering, Nanjing University of Finance and Economics, Nanjing 210023, China.

Plantaricin EmF separated and identified from 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Read More

View Article and Full-Text PDF
January 2022

H1 helix of colicin U causes phospholipid membrane permeation.

Biochim Biophys Acta Biomembr 2022 Jan 8;1864(4):183866. Epub 2022 Jan 8.

J. Heyrovský Institute of Physical Chemistry, Czech Academy of Sciences, Dolejškova 3, 18223 Prague, Czech Republic. Electronic address:

In light of an increasing number of antibiotic-resistant bacterial strains, it is essential to understand an action imposed by various antimicrobial agents on bacteria at the molecular level. One of the leading mechanisms of killing bacteria is related to the alteration of their plasmatic membrane. We study bio-inspired peptides originating from natural antimicrobial proteins colicins, which can disrupt membranes of bacterial cells. Read More

View Article and Full-Text PDF
January 2022

The characteristics and roles of antimicrobial peptides as potential treatment for antibiotic-resistant pathogens: a review.

PeerJ 2021 14;9:e12193. Epub 2021 Dec 14.

Department of Microbiology, Faculty of Biotechnology and Biomolecular Science, Universiti Putra Malaysia, Serdang, Selangor, Malaysia.

The emergence of antibiotic-resistant bacteria has become a significant and ever-increasing threat to global public health, increasing both morbidity and mortality rates, and the financial burden on health services. Infection by drug-resistant bacteria is anticipated to contribute to the demise of almost 10 million people by the year 2050 unless a competent and effective response is devised to engage with this issue. The emergence and spread of resistance are commonly caused by the excessive or inappropriate use of antibiotics and substandard pharmaceuticals. Read More

View Article and Full-Text PDF
December 2021

Isolation and identification of the oral bacteria and their characterization for bacteriocin production in the oral cavity.

Authors:
Saad Alghamdi

Saudi J Biol Sci 2022 Jan 6;29(1):318-323. Epub 2021 Sep 6.

Laboratory Medicine Department, Faculty of Applied Medical Sciences, Umm Al-Qura University, P.O.Box.715, Makkah 21955, Saudi Arabia.

Oral cavity is a diverse ecosystem which harbors immense diversity of microorganisms like fungi, virus and bacteria. Some of these microorganisms are involved in causing multiple infections. Oral flora is continuously changing due to connection with the external environment and produce bacteriocin against each other to compete for nutrient in this mini ecosystem. Read More

View Article and Full-Text PDF
January 2022

Bovicin HC5 and nisin reduce cell viability and the thermal resistance of Alicyclobacillus acidoterrestris endospores in fruit juices.

J Sci Food Agric 2022 Jan 8. Epub 2022 Jan 8.

Departamento de Microbiologia, Universidade Federal de Viçosa, Viçosa, Brazil.

Background: Alicyclobacillus acidoterrestris is an important thermoacidophilic spore-forming bacterium in fruit-juice deterioration, and alternative non-thermal methods have been investigated to control fruit juice spoilage. This work aimed to evaluate the capacity of bovicin HC5 and nisin to inhibit the growth of vegetative cells and reduce the thermal resistance of endospores of A. acidoterrestris inoculated (10 CFU mL ) in different fruit juices. Read More

View Article and Full-Text PDF
January 2022

Antibacterial activity of supernatants of Lactoccocus lactis, Lactobacillus rhamnosus, Pediococcus pentosaceus and curcumin against Aeromonas hydrophila. In vitro study.

Vet Res Commun 2022 Jan 8. Epub 2022 Jan 8.

Departamento de Morfología, Universidad Autónoma de Aguascalientes, Avenida Universidad 940, Colonia Ciudad Universitaria, Edificio 202, 20100, Aguascalientes, Mexico.

Secretions of beneficial intestinal bacteria can inhibit the growth and biofilm formation of a wide range of microorganisms. Curcumin has shown broad spectrum antioxidant, anti-inflammatory, and antimicrobial potential. It is important to evaluate the influence of these secretions with bioactive peptides, in combination with curcumin, to limit growth and inhibit biofilm formation of pathogenic bacteria of importance in aquaculture. Read More

View Article and Full-Text PDF
January 2022

Anticancer activity of lactic acid bacteria.

Semin Cancer Biol 2022 Jan 4. Epub 2022 Jan 4.

Department of Oral Microbiology, Medical Faculty, Medical University of Gdansk, 25 Dębowa Str., 80-204, Gdansk, Poland. Electronic address:

Lactic acid bacteria (LAB), a group of Gram-positive microorganisms naturally occurring in fermented food products and used as probiotics, have been gaining the interest of researchers for years. LAB are potent, albeit still not wholly understood, source of bioactive compounds with various functions and activity. Metabolites of LAB, among others, short-chain fatty acids, exopolysaccharides and bacteriocins have promising anticancer potential. Read More

View Article and Full-Text PDF
January 2022

Genomics: Chromosomal Diversity and Plasmidome Versatility.

Front Microbiol 2021 9;12:789929. Epub 2021 Dec 9.

Laboratory of Food and Environmental Microbiology, Earth and Life Institute, Louvain-la-Neuve, Belgium.

is the thermotolerant representative of the group. This group, also known as , comprises both beneficial and pathogenic members and includes psychrotolerant and thermotolerant species. was originally recovered from a fatal outbreak in France in 1998. Read More

View Article and Full-Text PDF
December 2021

FN1 produces an inhibitory substance that affects competition for nodule occupancy.

Can J Microbiol 2022 Jan 6. Epub 2022 Jan 6.

University of Manitoba, 8664, Microbiology, University of Manitoba, Winnipeg, Manitoba, Canada, R3T 2N2;

Bacteriocins are narrow spectrum antibiotics of bacterial origin that can affect competition in resource-limited environments such as the rhizosphere. Therefore, bacteriocins may be good candidates for manipulation in order to generate more competitive inocula for soybean. In this study, FN1 along with other Bradyrhizobia in our culture collection were screened for bacteriocin-like activity. Read More

View Article and Full-Text PDF
January 2022

Susceptibility to Bacteriocins of Multiresistant, Gene Possessing Strains from Lesions on Dogs in Vojvodina (Serbia).

Microb Drug Resist 2022 Jan 4. Epub 2022 Jan 4.

Department of Physiology, Laboratory of Animal Microbiology, Institute of Animal Physiology, Centre of Biosciences of the Slovak Academy of Sciences, Košice, Slovakia.

Staphylococci are considered commensal organisms; however, they can also cause diseases in animals. The species was originally isolated from the nares and anal mucosa of healthy dogs; nowadays, the incidence of methicillin-resistant strains in dogs has increased, and this species has also become the most common cause of canine skin lesions. were tested for their susceptibility to bacteriocins to show the potential of bacteriocins to eliminate/reduce as a causative agent. Read More

View Article and Full-Text PDF
January 2022

In vitro and genetic screening of probiotic properties of lactic acid bacteria isolated from naturally fermented cow-milk and yak-milk products of Sikkim, India.

World J Microbiol Biotechnol 2022 Jan 6;38(2):25. Epub 2022 Jan 6.

Department of Microbiology, School of Life Sciences, DAICENTER (DBT-AIST International Centre for Translational and Environmental Research) and Bioinformatics Centre, Sikkim University, Gangtok, 737102, Sikkim, India.

A total of 272 isolates of lactic acid bacteria (LAB) were isolated from 22 samples of naturally fermented milk products of Sikkim in India viz. dahi, soft-variety chhurpi, hard-variety chhurpi, mohi and philu, out of which, 68 LAB isolates were randomly grouped on the basis of phenotypic characteristics, and were identified by 16S rRNA gene sequence analysis. Leuconostoc mesenteroides was the most dominant genus, followed by Leuc. Read More

View Article and Full-Text PDF
January 2022

Bacteriocin-like inhibitory substances production by Enterococcus faecium 135 in co-culture with Ligilactobacillus salivarius and Limosilactobacillus reuteri.

Braz J Microbiol 2022 Jan 6. Epub 2022 Jan 6.

Department of Biochemical and Pharmaceutical Technology, Faculty of Pharmaceutical Sciences, University of São Paulo, Professor Lineu Prestes Avenue, São Paulo, SP, 580, Brazil.

The use of lactic acid bacteria (LAB) and probiotic cultures in the breeding of animals such as poultry and swine are quite common. It is known that those strains can produce bacteriocins when grown in pure culture. However, the production of bacteriocin using co-culture of microorganisms has not been much studied so far. Read More

View Article and Full-Text PDF
January 2022

Analysis of the Bioprotective Potential of Different Lactic Acid Bacteria Against in Cold-Smoked Sea Bass, a New Product Packaged Under Vacuum and Stored at 6 ± 2°C.

Front Microbiol 2021 20;12:796655. Epub 2021 Dec 20.

Department of Agricultural, Food, Environmental and Animal Science, Università degli Studi di Udine, Udine, Italy.

The aim of the work was to monitor the presence of in cold-smoked fish products (trout, salmon, and sea bass) marketed in Italy. Cold-smoked sea bass is a new product that has not yet been commercialized and was collected from the production facility. Monitoring data have shown that cold-smoked products can be contaminated by , the presence of which has been highlighted mainly by enrichment culture (presence in 25 g). Read More

View Article and Full-Text PDF
December 2021

Synergistic antimicrobial interactions of nisin A with biopolymers and solubilising agents for oral drug delivery.

Eur J Pharm Biopharm 2022 Jan 2. Epub 2022 Jan 2.

SSPC, the Science Foundation Ireland Research Centre for Pharmaceuticals, Department of Chemical Sciences, Bernal Institute, University of Limerick, Ireland. Electronic address:

In order to develop bacteriocins, like the lantibiotic nisin A, into effective alternatives to existing antibiotics, their biophysical and physicochemical properties must first be assessed, from solubility, to susceptibility and absorption. It has been well established that formulation strategies at early drug development stages can be crucial for successful outcomes during preclinical and clinical phases of development, particularly for molecules with challenging physicochemical properties. This work elucidates the physicochemical challenges of nisin A in terms of its susceptibility to digestive enzymes like pepsin, pancreatin and proteinase K and its poor solubility at physiological pHs. Read More

View Article and Full-Text PDF
January 2022

Genomic Analyses of Pediococcus pentosaceus ST65ACC, a Bacteriocinogenic Strain Isolated from Artisanal Raw-Milk Cheese.

Probiotics Antimicrob Proteins 2022 Jan 4. Epub 2022 Jan 4.

InsPOA - Laboratório de Inspeção de Produtos de Origem Animal, Departamento de Veterinária, Universidade Federal de Viçosa, Viçosa, MG, 36570 900, Brazil.

Pediococcus pentosaceus ST65ACC was obtained from a Brazilian artisanal cheese (BAC) and characterized as bacteriocinogenic. This strain presented beneficial properties in previous studies, indicating its potential as a probiotic candidate. In this study, we aimed to carry out a genetic characterization based on whole-genome sequencing (WGS), including taxonomy, biotechnological properties, bacteriocin clusters and safety-related genes. Read More

View Article and Full-Text PDF
January 2022

Selection of Beneficial Bacterial Strains With Potential as Oral Probiotic Candidates.

Probiotics Antimicrob Proteins 2022 Jan 4. Epub 2022 Jan 4.

ProBacLab, Department of Advanced Convergence, Handong Global University, Pohang, Gyeongbuk, 37554, Republic of Korea.

This study aimed to select beneficial strains from the oral cavity of healthy volunteers and to evaluate these as potential oral probiotic candidates. The selection process was based on the isolation, differentiation, identification, and safety assessment of LAB strains, followed by a series of experiments for the selection of appropriate candidates with beneficial properties. In the screening procedure, 8 isolates from the oral cavity of a Caucasian volunteers were identified as Streptococcus (Str. Read More

View Article and Full-Text PDF
January 2022

Isolation and partial characterization of a novel bacteriocin from Pseudomonas azotoformans with antimicrobial activity against Pasterella multocida.

Arch Microbiol 2022 Jan 4;204(1):112. Epub 2022 Jan 4.

College of Life Science, Jilin Agricultural University, Changchun, 130118, China.

In this study, a bacteriocin PA996 isolated from Pseudomonas azotoformans (P. azotoformans) was purified to homogeneity by ammonium sulphate precipitation and SP-Sepharose column chromatography. P. Read More

View Article and Full-Text PDF
January 2022

Assessing the potential of the two-peptide lantibiotic lichenicidin as a new generation antimicrobial.

World J Microbiol Biotechnol 2022 Jan 3;38(1):18. Epub 2022 Jan 3.

Department of Biology & Centre for Environmental and Marine Studies (CESAM), University of Aveiro, Aveiro, Portugal.

Lantibiotics are a promising class of natural antimicrobial peptides. Lichenicidin is a two-peptide lantibiotic in which two mature peptides act synergistically to exhibit full bioactivity. Considering the two-peptide lantibiotics described so far, only cytolysin has been deeply characterized in terms of toxicity towards eukaryotic cells and it was found to be hemolytic and cytotoxic. Read More

View Article and Full-Text PDF
January 2022

Anticancer properties of colicin E7 against colon cancer.

Prz Gastroenterol 2021 1;16(4):364-368. Epub 2021 Oct 1.

Department of Microbiology, School of Medicine, Ilam University of Medical Sciences, Ilam, Iran.

Introduction: Cancer is a major public health problem in the modern world. Every year, new cases of cancer are diagnosed around the world. Cancer cells are altered cells that have escaped the mechanisms that regulate natural growth. Read More

View Article and Full-Text PDF
October 2021

Genomic and metabolic features of the Lactobacillus sakei JD10 revealed potential probiotic traits.

Microbiol Res 2022 Mar 24;256:126954. Epub 2021 Dec 24.

Shanghai Veterinary Research Institute, Chinese Academy of Agricultural Science, No.518, Ziyue Road, Shanghai, 200241, PR China. Electronic address:

Lactic acid bacteria that inhabit in the lung play important roles in maintaining the microbiome balance by interacting with the host immune system. Numerous metabolites (e.g. Read More

View Article and Full-Text PDF

Antimicrobial activity of bacteriocin produced by a new Latilactobacillus curvatus sp.LAB-3H isolated from traditional yogurt.

Arch Microbiol 2021 Dec 29;204(1):101. Epub 2021 Dec 29.

Department of Microbiology, Faculty of Basic Sciences, Lahijan Branch, Islamic Azad University, P.O. Box 1616, Lahijan, Iran.

In recent years, the use of bacteriocin-producing Lactobacillus species has received much attention in different areas, including using as probiotics, food preservation, and as broad antimicrobial spectrum activity. In this study, a bacteriocin-producing Lactobacillus strain was isolated from traditional yogurt. The isolate was identified by morphological, biochemical, 16S rRNA analyses, and designated as Latilactobacillus curvatus LAB-3H. Read More

View Article and Full-Text PDF
December 2021

Pseudaestuariivita rosea sp. nov., isolated from Acmaea sp., a marine mollusk.

Arch Microbiol 2021 Dec 28;204(1):94. Epub 2021 Dec 28.

Marine College, Shandong University, Weihai, 264209, China.

A Gram-stain-negative, pink-pigmented, aerobic, non-motile and rod-shaped bacterium, designated as strain H15, was isolated from Acmaea sp., collected from Weihai, Shandong Province, China. The novel isolate was able to grow at 4-37 °C (optimum 33 °C), pH 5. Read More

View Article and Full-Text PDF
December 2021

Complete genome sequence of B20, a bacteriocin-producing pathogen.

J Anim Sci Technol 2021 Nov 30;63(6):1468-1472. Epub 2021 Nov 30.

Department of Animal Science and Technology, Chung-Ang University, Anseong 17546, Korea.

B20 was isolated from chicken feces collected from a local farm associated with Chung-Ang University (Anseong, Korea). The whole genome of B20 was sequenced using the PacBio RS II platform and assembled . The genome is 2,982,563 bp long and assembled in two contigs. Read More

View Article and Full-Text PDF
November 2021

Purification and Characterization of Plantaricin YKX and Assessment of Its Inhibitory Activity Against spp.

Front Microbiol 2021 9;12:783266. Epub 2021 Dec 9.

State Key Laboratory of Biobased Material and Green Papermaking, College of Food Science and Engineering, Qilu University of Technology, Shandong Academy of Science, Jinan, China.

Consumers prefer natural over synthetic chemical preservatives on a food label. Therefore, it is crucial to ensure the safety and efficacy of such natural preservatives. The emergence of heat-resistant spore-forming spp. Read More

View Article and Full-Text PDF
December 2021