4,594 results match your criteria = 01 well


The expression and mutation of and its association with litter size in small-tail Han sheep ().

Arch Anim Breed 2021 28;64(1):211-221. Epub 2021 May 28.

Key Laboratory of Animal Genetics, Breeding and Reproduction of Ministry of Agriculture and Rural Affairs, Institute of Animal Science, Chinese Academy of Agricultural Sciences, Beijing 100193, China.

Previous studies have shown that promotes follicular development and ovarian granulosa cell proliferation, thereby affecting ovulation in mammals. In this study, the expression and polymorphism of the gene associated with litter size in small-tail Han (STH) sheep were determined. The expression of was detected in 14 tissues of STH sheep during the follicular phase as well as in the hypothalamic-pituitary-gonadal (HPG) axis of monotocous and polytocous STH sheep during the follicular and luteal phases using quantitative polymerase chain reaction (qPCR). Read More

View Article and Full-Text PDF

Characteristics of cerebral ischemic stroke based on moyamoya disease and atherosclerosis-associated intracranial arterial stenosis.

Neurol Sci 2021 Jun 9. Epub 2021 Jun 9.

Department of Neurology, Xuanwu Hospital, Capital Medical University, Beijing, 100053, China.

Purpose: To analyze the characteristics of acute ischemic stroke (AIS) resulting from moyamoya disease (MMD) and intracranial large artery atherosclerotic stenosis (LAS).

Method: This real-world case control study enrolled imaging-confirmed AIS patients owing to MMD or LAS hospitalized from January 2015 through September 2020 consecutively. The features of risk factors, peripheral blood, and imaging presentations were compared between the two cohorts. Read More

View Article and Full-Text PDF

The anti-Müllerian hormone gene's second exon is associated with the reproductive performance of Jinghai Yellow chickens.

Arch Anim Breed 2021 5;64(1):45-52. Epub 2021 Feb 5.

Jiangsu Key Laboratory of Animal Genetic Breeding and Molecular Design, College of Animal Science and Technology, Yangzhou University, Yangzhou, China.

Anti-Müllerian hormone (AMH), a member of the transforming growth factor- superfamily, plays important regulatory roles in follicular development and sex differentiation. Although much has been learned about the impact of polymorphisms of on reproduction in animals, the effect on chicken reproduction is not well explored. In this study, the polymorphism of five exons of gene and its effect on the reproductive performance of Jinghai Yellow chickens were studied. Read More

View Article and Full-Text PDF
February 2021

Thin Film Plastic Antibody-Based Microplate Assay for Human Serum Albumin Determination.

Polymers (Basel) 2021 May 27;13(11). Epub 2021 May 27.

Department of Physical Chemistry, Faculty for Chemistry, University of Vienna, 1090 Vienna, Austria.

Herein we demonstrate molecularly imprinted polymers (MIP) as plastic antibodies for a microplate-based assay. As the most abundant plasma protein, human serum albumin (HSA) was selected as the target analyte model. Thin film MIP was synthesized by the surface molecular imprinting approach using HSA as the template. Read More

View Article and Full-Text PDF

δ-Lactones-A New Class of Compounds That Are Toxic to K12 and R2-R4 Strains.

Materials (Basel) 2021 May 30;14(11). Epub 2021 May 30.

Institute of Organic Chemistry PAS, Kasprzaka 44/52, 01-224 Warsaw, Poland.

Lactones are among the well-known organic substances with a specific taste and smell. They are characterized by antibacterial, antiviral, anti-inflammatory, and anti-cancer properties. In recent years, among this group of compounds, new biologically active substances have been searched by modifying the main (leading) structure with new analogs with stronger or different responses that may have a toxic effect on the cells of pathogenic bacteria and constitute an alternative to commonly used antibiotics. Read More

View Article and Full-Text PDF

Transcriptomic analysis of atopic dermatitis in African Americans is characterized by Th2/Th17-centered cutaneous immune activation.

Sci Rep 2021 May 27;11(1):11175. Epub 2021 May 27.

Department of Dermatology, Johns Hopkins University School of Medicine, Baltimore, MD, USA.

Atopic dermatitis (AD) often presents more severely in African Americans (AAs) and with greater involvement of extensor areas. To investigate immune signatures of AD in AAs with moderate to severe pruritus, lesional and non-lesional punch biopsies were taken from AA patients along with age-, race-, and sex-matched controls. Histology of lesional skin showed psoriasiform dermatitis and spongiotic dermatitis, suggesting both Th2 and Th17 activity. Read More

View Article and Full-Text PDF

Global sagittal alignment of the spine, pelvis, lower limb after vertebral compression fracture and its effect on quality of life.

BMC Musculoskelet Disord 2021 May 24;22(1):476. Epub 2021 May 24.

Department of Orthopaedics and Traumatology, Faculty of Medicine, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong SAR, China.

Background: Vertebral compression fractures (VCFs) are the most common among all osteoporotic fractures. The body may compensate to the kyphosis from vertebral compression fractures with lordosis of the adjacent spinal segments, rotation of the pelvis, knee flexion and ankle dorsiflexion. However, the detailed degree of body compensation, especially the lower limb, remains uncertain. Read More

View Article and Full-Text PDF

Estimating aquatic plant diversity and distribution in rivers from Jingjinji region, China, using environmental DNA metabarcoding and a traditional survey method.

Environ Res 2021 Aug 21;199:111348. Epub 2021 May 21.

Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing, 100085, China; Beijing Key Laboratory of Industrial Wastewater Treatment and Reuse, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing, 100085, China; University of Chinese Academy of Sciences, Beijing, 100049, China. Electronic address:

Traditional survey methods (TSMs) are difficult to use to perform a census of aquatic plant diversity completely in river ecosystems, and improved aquatic plant community monitoring programs are becoming increasingly crucial with a continuous decline in diversity. Although environmental DNA (eDNA) metabarcoding has been applied successfully to assess aquatic biodiversity, limited work has been reported regarding aquatic plant diversity in rivers. In this study, the efficiency of eDNA to estimate the aquatic plant diversity and spatial distribution of rivers from the Jingjinji (JJJ) region was evaluated by comparing results obtained by the TSM. Read More

View Article and Full-Text PDF

Dietary supplementation with N-carbamoylglutamate initiated from the prepartum stage improves lactation performance of postpartum dairy cows.

Anim Nutr 2021 Mar 22;7(1):232-238. Epub 2020 Oct 22.

Institute of Dairy Science, MoE Key Laboratory of Molecular Animal Nutrition, College of Animal Sciences, Zhejiang University, Hangzhou, 310058, China.

The objective of this study was to investigate the effects of supplementing N-carbamoylglutamate (NCG), an Arg enhancer, on amino acid (AA) supply and utilization and productive performance of early-lactating dairy cows. Thirty multiparous Chinese Holstein dairy cows were randomly divided into control (CON,  = 15) and NCG (CON diet supplemented with NCG at 20 g/d per cow,  = 15) groups at 4 wk before calving. Diets were offered individually in tie-stalls, and NCG was supplemented by top-dress feeding onto total mixed ration for the NCG group. Read More

View Article and Full-Text PDF

CT Based Analysis of Acetabular Morphology in Northern Indian Population: A Retrospective Study.

Indian J Orthop 2021 Jun 20;55(3):606-613. Epub 2020 Oct 20.

Department of Orthopaedics, All India Institute of Medical Sciences, Rishikesh, Rishikesh, Uttarakhand 249201 India.

Purpose: The acetabular morphology has shown to differ among different regions of the world. Multiplanar evaluation by computed tomography (CT) scan is the key to assess acetabular depth, version, and inclination at the same time which have been rarely explored before in the Indian population. We present an anthropometric study of the native acetabulum by CT based coronal, sagittal, and axial parameters in the Northern Indian population. Read More

View Article and Full-Text PDF

The impact of genetic risk on liver fibrosis in non-alcoholic fatty liver disease as assessed by magnetic resonance elastography.

Aliment Pharmacol Ther 2021 Jul 11;54(1):68-77. Epub 2021 May 11.

Division of Gastroenterology, NAFLD Research Center, University of California at San Diego, La Jolla, CA, USA.

Background: Variants in multiple genetic loci modify the risk of non-alcoholic fatty liver disease (NAFLD) and cirrhosis but there are limited data on the quantitative impact of variant copies on liver fibrosis.

Aim: To investigate the effect of PNPLA3, TM6SF2, MBOAT7, GCKR and HSD17B13 genotype on liver fibrosis assessed by magnetic resonance elastography (MRE), a reproducible, accurate, continuous biomarker of liver fibrosis.

Methods: This is a cross-sectional analysis derived from a well-characterised cohort at risk for NAFLD who underwent genotyping and MRE assessment. Read More

View Article and Full-Text PDF

Race-specific changes in endothelial inflammation and microRNA in response to an acute inflammatory stimulus.

Am J Physiol Heart Circ Physiol 2021 Jun 7;320(6):H2371-H2384. Epub 2021 May 7.

Department of Kinesiology, School of Public Health, University of Maryland, College Park, Maryland.

Both aberrant vascular reactivity to acute cardiovascular stress and epigenetic mechanisms such as microRNA (miR) may underlie the increased propensity for African Americans (AA) to develop cardiovascular disease. This study assessed racial differences in acute induced endothelial inflammation and related miRs. Cultured human umbilical vein endothelial cells (HUVECs) derived from AA and Caucasian Americans (CA) were exposed to influenza vaccine to determine changes in inflammatory markers, endothelial nitric oxide synthase (eNOS), and miR expression/release. Read More

View Article and Full-Text PDF

A novel nonenzymatic ascorbic acid electrochemical sensor based on gold nanoparticals-chicken egg white-copper phosphate-graphene oxide hybrid nanoflowers.

Nanotechnology 2021 May 21;32(32). Epub 2021 May 21.

School of Materials Science and Engineering, Shaanxi Key Laboratory of Green Preparation and Functionalization for Inorganic Materials, Shaanxi University of Science and Technology, Xi'an 710021, People's Republic of China.

Au-CEW-Cu(PO)-GO nanoflowers (HNFs), which were assembled of gold nanoparticals (Au NPs), chicken egg white (CEW), copper phosphate (Cu(PO)) and graphene oxide (GO) together to form a flower-like organic/inorganic hybrid nanocomposite, were synthesized through a simple and gentle one-pot co-precipitation method. The prepared samples were well characterized by scanning electron microscope, transmission electron microscope, energy dispersive x-ray spectrometer, x-ray diffraction and Raman spectrometer. The prepared Au-CEW-Cu(PO)-GO HNFs was used to modify glassy carbon electrode to fabricate an electrochemical sensor for detection of ascorbic acid (AA). Read More

View Article and Full-Text PDF

Antioxidant Properties of Galanin and Its N-Terminal Fragments in in vitro and in vivo Oxidative Stress Modeling.

Biochemistry (Mosc) 2021 Apr;86(4):496-505

National Medical Research Center for Cardiology, Ministry of Health of the Russian Federation, Moscow, 121552, Russia.

Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue WTLNSAGYLLGPβAH (G2) were studied in vivo in the rat model of regional myocardial ischemia and reperfusion and in vitro in the process of Cu2+-induced free radical oxidation of human blood plasma low-density lipoproteins. Intravenous administration of G1, G2, and Gal to rats after ischemia induction reduced the infarction size and activities of the necrosis markers, creatine kinase-MB and lactate dehydrogenase, in blood plasma at the end of reperfusion. G1, G2, and Gal reduced formation of the spin adducts of hydroxyl radicals in the interstitium of the area at risk during reperfusion, moreover, G2 and Gal also reduced formation of the secondary products of lipid peroxidation in the reperfused myocardium. Read More

View Article and Full-Text PDF

Epiretinal Membrane Vitrectomy With and Without Intraoperative Intravitreal Dexamethasone Implant: A Systematic Review With Meta-Analysis.

Front Pharmacol 2021 15;12:635101. Epub 2021 Apr 15.

Department of Surgical Sciences, Eye Clinic Section, University of Turin, Turin, Italy.

To evaluate the efficacy of vitrectomy combined with intravitreal dexamethasone implant vs. vitrectomy without the implant in patients with epiretinal membrane (ERM) by conducting a systematic review and meta-analysis. Studies that compared ERM vitrectomy with and without intraoperative dexamethasone implant with a follow-up ≥3 months were included. Read More

View Article and Full-Text PDF

Surgical and quality of life outcomes after pelvic organ prolapse surgery in older postmenopausal women.

Prz Menopauzalny 2021 Apr 15;20(1):21-28. Epub 2021 Mar 15.

Department of Obstetrics and Gynecology, Ain Shams University, Cairo, Egypt.

Introduction: To evaluate the surgical outcome, and quality of life (QoL) 12-months after Le Fort colpocleisis (LFC), and sacrospinous fixation (SSF) in older postmenopausal women.

Material And Methods: Eighty-six (86) post-menopausal women were included in this study (38 in the LFC group and 48 in the SSF group). Pelvic organ prolapse quantification (POP-Q) was used to evaluate the participants' pelvic organ prolapse (POP) pre-operatively and post-operatively (PO). Read More

View Article and Full-Text PDF

The association between XRCC3 rs1799794 polymorphism and cancer risk: a meta-analysis of 34 case-control studies.

BMC Med Genomics 2021 Apr 30;14(1):117. Epub 2021 Apr 30.

Department of Oncology, the First Affiliated Hospital of Kunming Medical University, Yunnan Province, No. 295 Xichang Road, Kunming, 650032, People's Republic of China.

Background: Studies on the XRCC3 rs1799794 polymorphism show that this polymorphism is involved in a variety of cancers, but its specific relationships or effects are not consistent. The purpose of this meta-analysis was to investigate the association between rs1799794 polymorphism and susceptibility to cancer.

Methods: PubMed, Embase, the Cochrane Library, Web of Science, and Scopus were searched for eligible studies through June 11, 2019. Read More

View Article and Full-Text PDF

Effects of rumen-protected methionine supplementation on the performance of high production dairy cows in the tropics.

PLoS One 2021 30;16(4):e0243953. Epub 2021 Apr 30.

Department of Animal Science, Federal University of Jataí, GO, Brazil.

Increasing methionine availability in dairy cow diets during the first third of lactation may enhance their performance and health. The aim of this study was to determine the effect of supplementing rumen-protected methionine (Smartamine® M, SM) in a lactation diet with protein and energy levels calculated according to the literature. Seventy-six multiparous Holstein cows (39. Read More

View Article and Full-Text PDF

Experimental and Computational Studies on Structure and Energetic Properties of Halogen Derivatives of 2-Deoxy-D-Glucose.

Int J Mol Sci 2021 Apr 2;22(7). Epub 2021 Apr 2.

Independent Laboratory of Genetics and Molecular Biology, Kaczkowski Military Institute of Hygiene and Epidemiology, Kozielska 4, 01-163 Warsaw, Poland.

The results of structural studies on a series of halogen-substituted derivatives of 2-deoxy-D-glucose (2-DG) are reported. 2-DG is an inhibitor of glycolysis, a metabolic pathway crucial for cancer cell proliferation and viral replication in host cells, and interferes with D-glucose and D-mannose metabolism. Thus, 2-DG and its derivatives are considered as potential anticancer and antiviral drugs. Read More

View Article and Full-Text PDF

Longitudinal associations of sleep problems with alcohol and cannabis use from adolescence to emerging adulthood.

Sleep 2021 Apr 22. Epub 2021 Apr 22.

RAND Corporation, Behavioral and Policy Sciences, 1776 Main Street, Santa Monica, CA 90407-2138, USA.

Study Objectives: This study examined longitudinal associations of sleep problems with alcohol and cannabis use across six annual waves of data from adolescence to emerging adulthood.

Methods: Participants were 3,265 youth from California (ages 16 to 22 across waves). At each wave, past-month alcohol use and cannabis use, mental health, and several dimensions of sleep health (i. Read More

View Article and Full-Text PDF

[Clinical study of dienogest in the treatment of refractory endometriosis-associated pain].

Zhonghua Fu Chan Ke Za Zhi 2021 Mar;56(3):178-184

Department of Obstetrics and Gynecology, Peking University Third Hospital, Beijing 100191, China.

To evaluate the efficacy and safety of dienogest (DNG) in the treatment of refractory endometriosis-associated pain (REAP). In this study, REAP was defined according to the following criteria: (1) the pain duration was ≥12 months and visual analogue scale (VAS)≥60 mm; (2) the previous treatments with over two medicines like oral contraceptives and levonorgestrel-releasing intrauterine system failed to achieve satisfactory relief of pain, with VAS reduction less than 50%; with gonadotropin-releasing hormone agonist or mifepristone, the pain could be controlled temporarily, but it recurred after discontinuation of medicines; (3) the pain could not be relieved by surgery or even repeated surgeries. In the present study, 48 patients with REAP were treated with DNG 2 mg/day orally and the clinical outcomes were retrospectively analyzed. Read More

View Article and Full-Text PDF

Add-on effect of plum-blossom needling in alopecia areata: a qualitative evidence synthesis.

Ann Palliat Med 2021 Mar;10(3):3000-3008

Shanghai Skin Disease Hospital, Tongji Medical University, Shanghai, China.

Background: Alopecia areata (AA) is highly unpredictable, and therapeutic efficacy remains variable, which often prompts patients to seek alternative therapies. Plum-blossom needling has been widely used for thousands of years. The purpose of this meta-analysis was to critically evaluate the add-on effect of plum-blossom needling in AA and compared it with that of conventional treatment, which would provide guidance for AA therapy. Read More

View Article and Full-Text PDF

Evolution of the liver biopsy and its future.

Transl Gastroenterol Hepatol 2021 5;6:20. Epub 2021 Apr 5.

Department of Environmental Health Sciences, Yale School of Public Health, New Haven, CT, USA.

Liver biopsies are commonly used to evaluate a wide variety of medical disorders, including neoplasms and post-transplant complications. However, its use is being impacted by improved clinical diagnosis of disorders, and non-invasive methods for evaluating liver tissue and as a result the indications of a liver biopsy have undergone major changes in the last decade. The evolution of highly effective treatments for some of the common indications for liver biopsy in the last decade (e. Read More

View Article and Full-Text PDF

Global Changes of 5-mC/5h-mC Ratio and Methylation of Adiponectin and Leptin Gene in Placenta Depending on Mode of Delivery.

Int J Mol Sci 2021 Mar 21;22(6). Epub 2021 Mar 21.

First Department of Obstetrics and Gynaecology, Centre of Postgraduate Medical Education, Żelazna 90, 01-004 Warsaw, Poland.

It was suggested that the epigenetic alterations of the placenta are associated with obesity, as well as the delivery mode. This study aimed to assess the effect of maternal outcome and delivery procedure on global placental DNA methylation status, as well as selected 5'-Cytosine-phosphate-Guanine-3' (CpG) sites in and genes. Global DNA methylation profile in the placenta was assessed using the 5-methylcytosine (5-mC) and 5-hydroxymethylcytosine (5-hmC) ratio evaluated with the ELISA, followed by target gene methylation patterns at selected gene regions which were determined using methylation-specific qPCR in 70 placentas from healthy, pregnant women with single pregnancy. Read More

View Article and Full-Text PDF

The Impact of Insulin on Low-dose Metronomic Vinorelbine and Mafosfamide in Breast Cancer Cells.

Anticancer Res 2021 Mar;41(3):1243-1250

Clinic for Obstetrics and Women's Health, University Medical Center Mainz, Mainz, Germany.

Background/aim: Breast cancer (BC) may be affected by diabetes and anti-diabetic medication, as well as its therapeutic agents. Low-dose metronomic chemotherapy (LDMC) is an available treatment option in BC. We investigated the impact of insulin on low-dose metronomic vinorelbine and mafosfamide in BC cell lines. Read More

View Article and Full-Text PDF

A pioneering study indicate role of GABRQ rs3810651 in ASD severity of Indo-Caucasoid female probands.

Sci Rep 2021 Mar 26;11(1):7010. Epub 2021 Mar 26.

Manovikas Biomedical Research and Diagnostic Centre, Manovikas Kendra, 482 Madudah, Plot I-24, Sector J, EM Bypass, Kolkata, West Bengal, 700107, India.

Alteration in gamma aminobutyric acid (GABA), the principal inhibitory neurotransmitter, is speculated to be a potential risk factor for Autism Spectrum Disorder (ASD) due to an altered expression in the brain. Sensory, social, and emotional deficits of subjects with ASD were reported to be caused by an imbalance between excitatory and inhibitory neurotransmission as well as GABAergic dysfunction caused by inadequate receptor function. We for the first time studied association between ASD and a missense coding variant rs3810651 (I478F) in the GABRQ gene, encoding for one of the subunits of GABA receptors. Read More

View Article and Full-Text PDF

Epigenetic age in young African American adults with perinatally-acquired HIV.

J Acquir Immune Defic Syndr 2021 Mar 18. Epub 2021 Mar 18.

Department of Biostatistics and Epidemiology, Rutgers School of Public Health, Piscataway, NJ, USA Department of Medicine, College of Physicians and Surgeons, Columbia University Irving Medical Center, New York, NY, USA Gertrude H. Sergievsky Center, College of Physicians and Surgeons, Columbia University Irving Medical Center, New York, NY, USA Department of Environmental Health Sciences, Mailman School of Public Health, Columbia University Irving Medical Center, New York, NY, USA Department of Pediatrics, College of Physicians and Surgeons, Columbia University Irving Medical Center, New York, NY, USA ICAP at Columbia, Mailman School of Public Health, Columbia University Irving Medical Center, New York, NY, USA.

Background: Prior studies have measured accelerated aging in people with HIV (PWH) using a DNA methylation (DNAm)-based biomarker of aging, "epigenetic age", but data are limited in African American (AA) young adults with perinatally-acquired HIV infection (PHIV).

Methods: We performed a cross-sectional study of AA young adults ages 20-35 years with PHIV (N=31) and seronegative controls (N=30) using DNAm measured in whole blood and cognitive function measured by the NIH Toolbox. Illumina EPIC Array was utilized to measure DNAm age, and accelerated aging markers including epigenetic age acceleration (EAA), as well as extrinsic (EEAA) and intrinsic (IEAA) epigenetic age acceleration. Read More

View Article and Full-Text PDF

Effects of alcohol sensitivity on alcohol-induced blackouts and passing out: An examination of the alcohol sensitivity questionnaire among underage drinkers.

Alcohol Clin Exp Res 2021 05 7;45(5):1149-1160. Epub 2021 Apr 7.

Department of Psychological Sciences, University of Missouri, Columbia, MO, USA.

Background: The role of alcohol sensitivity in the experience of blacking out and passing out has not been well established. Here, we examined the relation between individual differences in alcohol sensitivity (i.e. Read More

View Article and Full-Text PDF

Lifestyle coaches as a central professional in the health care network? Dynamic changes over time using a network analysis.

BMC Health Serv Res 2021 Mar 19;21(1):247. Epub 2021 Mar 19.

Department of Health Promotion, Maastricht University, P.O. Box 616, Maastricht, 6200 MD, The Netherlands.

Background: Overweight and obesity are problems that are increasing globally in both children as well as adults, and may be prevented by adopting a healthier lifestyle. Lifestyle coaches counsel overweight and obese children (and their parents) as well as adults in initiating and maintaining healthier lifestyle behaviours. It is currently unclear whether this novel professional in the Dutch health care system functions as a linchpin in networks that evolve around lifestyle-related health problems. Read More

View Article and Full-Text PDF

Association of Vitamin D Levels, Race/Ethnicity, and Clinical Characteristics With COVID-19 Test Results.

JAMA Netw Open 2021 03 1;4(3):e214117. Epub 2021 Mar 1.

The University of Chicago, Chicago, Illinois.

Importance: Deficient (ie, <20 ng/mL) or insufficient (ie, 20 to <30 ng/mL) 25-hydroxyvitamin D (also known as calcifediol) levels are more common in Black individuals than White individuals and are associated with increased coronavirus disease 2019 (COVID-19) risk. Whether COVID-19 risk is associated with differences in vitamin D levels of 30 ng/mL or greater is not known.

Objective: To examine whether COVID-19 test results are associated with differences in vitamin D levels of 30 ng/mL or greater, including for White individuals and for Black individuals. Read More

View Article and Full-Text PDF